PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.009G094300.1
Common NamePHAVU_009G094300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family HB-other
Protein Properties Length: 338aa    MW: 37878.9 Da    PI: 5.0389
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.009G094300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox253.2e-08272318753
                         --HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
            Homeobox   7 ftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                         ++k  +++Le+++++++ p+ +++  + + ++++ ++V  WF  +R 
  Phvul.009G094300.1 272 LKKAHVDTLERVYRRSKRPTDAMISSIVHVTNIPRKRVVKWFEDKRV 318
                         6788899************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.199263323IPR001356Homeobox domain
SuperFamilySSF466897.7E-8266325IPR009057Homeodomain-like
CDDcd000863.12E-6269317No hitNo description
SMARTSM003896.6E-4269327IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.9E-6271319IPR009057Homeodomain-like
PfamPF000461.0E-5272318IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002229Biological Processdefense response to oomycetes
GO:0009414Biological Processresponse to water deprivation
GO:0009682Biological Processinduced systemic resistance
GO:0009787Biological Processregulation of abscisic acid-activated signaling pathway
GO:0010118Biological Processstomatal movement
GO:0050832Biological Processdefense response to fungus
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000071Biological Processregulation of defense response by callose deposition
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MSAAFQCLWG APTEPFLVPV QSLTLPFHRK PFFCSVPHYS PARNLSSVIV AASSKKKKNK  60
KKLSRHHVTE GGEEDMDAFE LLFKQLEQDL KRGDLSDDDG EGGITEEEMA LLERELDNAL  120
GDFDSELLNS DVIDIELGSD PENDGNGDGG EGEGEGEGED GDEKQLNLKN WQMKKLARAL  180
KAGRRKTSIK NLAADLCLDR ALVLQLLREP PPDLLMMSLT IPDEPTTTVV SLETKPSEIL  240
LQEISIDQTE SEPKANVPIH TLQRNWDAQK RLKKAHVDTL ERVYRRSKRP TDAMISSIVH  300
VTNIPRKRVV KWFEDKRVEE GVPDHRLPYQ RSVPETA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150351e-127AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007137036.10.0hypothetical protein PHAVU_009G094300g
SwissprotQ8H0V54e-72OCP3_ARATH; Protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3
TrEMBLV7AUN70.0V7AUN7_PHAVU; Uncharacterized protein
STRINGGLYMA04G07230.11e-166(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101813138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11270.13e-71overexpressor of cationic peroxidase 3